該頁無縮略圖
Indicators and Goals
TheCompanardancewthth0EromentalManagent stmstandardsets anualnviroental prtti goals claritablrackndstatistihadeuthllsactiil ronmental protection requirements.
Management of Ship Sewage
TheCompanyhasforulatedrelevant lsandregulationssuhasEnviromntalProtectionMangementProeursandth strutionlfrlaactiitfdihasteat terstregthtaaentfroetalrttiobardhdeuthataltreeureuhicha complwtthrquirementfntationentsddmestiandliongradualecethgert discharges of sewage and garbage from ships.
Oily Wastewater
DomesticWastewater Ballast Water
Ships are equipped with anti-pollution equipment including oilwater separators and oilcontentmeters, andthesedevicesareregularlyinspected and maintained to ensure reliable operation.Oily wastewateris strictlystored indesignated compartments and effectively treatedthroughoil-waterseparatorsorsenttoshorefor treatment, withthetreatmentprocessrecorded indetail in theoil treatmentlog.
Shipsareequippedwithdomesticsewagetreatmentdevicesand operate themtoensuresewage is effectively treated.During port stays,shipswith sewage collection cabinets shall not discharge sewage directly.Ships without sewage collection cabinets shall treat sewage before discharge. All operationsmust be documented,and a proofofreceiptmustberetained.
For ballast water containing, in particular, oily or noxious liquids,ships must check the qualityofthewatertoensure thatitisfreeofcontamination beforeit ispumpedintothe ballastwater,and complywith the anti-pollution convention when it is discharged, and all operationsarerecordedinthe relevant logbooks..
WastewaterDischargefromShips
TotalWastewaterDischargefromShips(WastewaterDischargedintoSeaandCollectedOnShore) 123,860.87
Wastewater Discharge Intensity 84.14m-/RMB 1 Milion (Operating Revenue)
DischargedWaterDischargedwaterthatcomplieswithrelevantregulationscanbedichargedintotheseadirectly
orafter meetingrelevantstandardsupontreatment)
116,439.78
WastewaterCollectedandTreatedOnshore 7,421.08m
DomesticWastewater 35.00m
SewagefromEngineRoom 231.13m
SewagefromShampoosRoom 7,154.95m3
Management of Waste Gas
TheCompanhasstablihdregulatiossuhasthetrutionsforrevetinirPotionfrmShtolearlydefithemae mentrequirements andoperational proceduresforshipexhaustemissions.
·Assign specialized personnel toregularly maintain and service anti-pollution equipment, and test pollutionmonitoring devices to ensure the effectiveness and reliability of pollution control equipment and procedures.
·For operations such as cleaning tanker,discharging ballast water,and painting inharbor waters,obtainpriorapprovalfromtherelevant departments asrequired,andfully control the pollutionrisks of therelated operations.
Adopt low-emission andhigh-efficiency equipment andcleanfuel technologies, promotetheimplementationoftechnologicalreformsforshipenvironmentalprotection,equipall ships withvolatile organic compounds(VoCs)collection devices,and install selective catalytic reduction (SCR) denitrification devices fornew ships.
·Strictly standardize the operation,maintenance and overhaul processes of equipment and treatment devices to avoid the escape of gases during operation,and reduce the emission of gaseous pollutants such as nitrogen oxides,sulfur dioxide, particulatesandVoCsinamulti-dimensional manner.
Waste GasEmissions
Disposal of Wastes
TheCompanhasformulatedregulationssuchasEvironmentalProtectionManagementProcdureandShipWasteMangemetPlan ttflailr ofwasteeeratdithefheratareifcitinaeaderealfra contiuestooptimizethemangement processtoreducethegenerationofgarbagefrmshpsandiscomitedtthemaintenance of ecological balance.During the Reporting Period, the compliant disposal rate of wastes was 100%
Prevention of Oil Spill Incidents
Adhere tothe philosophyofprioriting safetyinpollution prevention,theCompany strengthened the emergencyoilpillinidetnldngenuringthatperatingshparecertifidandldantplutncertifat Standarddisposalproceduresareestablishedforoperationssuchasballastwaterdischargeanddeckopera tinswhichmayeadtoilpillandperationaldrillareconductedrewmemberwarenessfpollton preventionandemergencyoperational capabilitiesarestrengthened tofundamentallyensurenospilsorleaks”
Control of Ship Wastes
RegulatingtheemissionbehaviorsinaccordancewiththeInternationalConventionforthePreventionofPollutionfromShipsMARPOLand theDischargeStandardforWaterPollutantsfromShipstheCompanyadhere to the principle of prioritizing on-shore treatment, improves the operational processes and supporting facilties fortheeneratinoltinstorageandrecclingfshgabageandptmizemanagment tprgrel reduces the generation of shipgarbage.
Emission ofWastes
Volume of non-hazardous waste generated 352.80m
generationintensity of non-hazardous waste 0.24ms/ RMB 1 Milion (Operating Revenue)
Volume of hazardous waste generated 518.84m
Generationintensityofhazardouswaste 0.35ma/ RMB Millon(Operatig eveue)
WasteDischarge
2024 Key Performance
WasteDischarged underMARPOL Annex V (Food Waste) 91.88ms
VolumeBurned inIncinerator 8.18m±
Volume Discharged into Collection Facilities 771.59m
Notes:
Improvement of Resource Efficiency
Upholdingthmaaentplhfenirntalrttioegyneatinancarmayni iprovesthenfifshaacrantutiatfrtnthth consumionhavigationndrlatbissactiangaratthtranrtatiseiwhlinizinth dencenadnutiofaturaluer,mayactilxlorandalitgianpre topromoteitsreenandlcarbontransformationanduportthecarbonizationprocesof theshippingidust
Energy Management
Governance
The Company, in strict compliance with the IMO's Ship Energy Efficiency ManagementPlanand theMeasuresforShipEnergyConsumptionData andCarbonIntensityManagementof theMaritimeSafetyAdministration, has established systems and procedures such as the Energy Conservation and Emission Reduction ManagementProcedures.Multiple measures are taken to upgrade the green performance of ships,ensure energy is used reasonably and efficiently,and minimize negative environmental impacts on the marine environment and waste generation.
The General Manager is responsible for approving the Company's energy conservation and emission reduction measures; the Engine Department is responsible for developing the Ship Energy Efficiency ManagementPlan and providing guidance and monitoring of ship processes,urging ships to collect and report their energy efficiency data monthly and conducting a comprehensivereview of energy conservation and emission reduction efforts every six months; the Marine Department is responsible for analyzing the energy conservation and emission reduction status of shipvoyages andoptimizing energy-saving and emission-reduction indicators andmeasuresyearbyyearbased on theresults.
Strategy
| Riske | Description of Risks | Finapsial | ImpactDura- | Countermeasures | |
| Market | Fuls tuationsinfuelpricesdirectlyaffectthe wars,whichmay lead to an increase in theCompany'sfuelprocurementcosts and raise operating costs. | Cost increase | Short-term | Operations | Izatinzeshieerag feenc inrovfuetti costs. along vesselroutes,and utilize_professionalmar- ket analysisteamsor toolstoforecastfuelprice trends and optimize procurement strategies. |
| Type pftu- nities | Description of Opportunities | Finapncial | Duraicen | Value Linhaim- pacted | Countermeasures |
| Tech- | The powerful data analysis and comput- ing capabilitiesofAl largemodelsarelev- tions,therebyreducing fuelenergy con- sumption. | Reduction in | Long-term | Operations | IntegrateAl-poweredintelligentanalysisinto |
Impact,Risk and Opportunity Management
To adressthecrtaintiought abt byinteationalolpriceftuatiogpltical conficts andchagineney anddemand,thCmannhanintheenegyrismanaetlelymnitrntationloiriandsuppl change anale d astheld andat ffpreftuation ad flaterepin rmaaemnt str gies.
TheComatablifpriarhanistregthnmarktadaaliandreab releniset shsalngshproveraginprfesnalmartanalsistemsrtolpretprietred reduce theact of fu prcefctuationsnbusinsoperationsbmeanschasoptimiing prurent strateisandlckng procurement prices in advance,thereby achieving the goal of controlling energy risks.
Indicators and Goals
he Comanycontiumrovs energyconseationand eisionreduction practicesforshipsand sets secificrequirements fo hipenergyconsumption-related goals and indicators,thus promoting therational andeffectiveuseof energy.
Indicator
Green Transformation of Ships
TheComaactilmtthgretrasfoatf shipliaainengyfft shdiad eyeffihhdforchgrlut h releathqitftrehfthliiai line with the “One Out, One \boldsymbol{\ln^{*}} policy of theMinistry fTransport,relaces olerships withnewlybuilt shipsbuilsyounger andhigher-end ships,and enhances the competitiveness and market service capacity of ships.
Kepingdstttytitigrcarintlihpp on the sigingof contractsfor thebuilingof590Wmethaldualful stainls steechemical tankersin3,theC signed thecontractsforanthertwshipsof thesametypen2024AsoftheendoftheReportinPeriod,theComanyhsfou 2590Wmthanlduafl stainlessteechmicaltanerudeontrutionandthfltontiutchieland greener development.
ImplementationofFuelSubstitution
Useof Methanol asanAlternative Fuel for New Ships
EnergyEfficientDesignofNewShips
●Conduct lightweight design and hull shape structure optimization for newly built ships, apply energy-saving devices and anti-friction coatings on existing ships to reduce navigationresistance andimprove energy efficiency.
IntelligentEnergyEfficiencyManagement(DOSS-E)
·Providereal-timemonitoringand evaluation of ship energy efficiency information ●Put forward optimization proposals including speed, longitudinal inclination and fouling,to improve operational energy efficiency,reduce fuel costs, and enhance the energy efficiency management level.
EnergyEfficiencyRetrofitsfon OlderShips
●Recycling of Waste Heat:Use the wasteheatfromboilers to insulate cargo and reduce fuel consumptionby retrofitting the boilers and waste heat recovery systems on ships.
Optimization of Operational Efficiency
Enhancement of Energy-saving Promotion
·SpeedAdjustment:Determineminimumballast amount and optimal draft difference,ensure best speed andreduce thefuel unit consumptionwhile ensuring therudder efficiency and sufficient propulsion effectiveness,based on the ships'load and ballast condition during navigation.
Conductenergy-savingandemission-reduction promotional activities from time to time,and continuouslypublicizeenergy-saving and emission-reduction management objectives， technical guidance for project identification and operation, and the application of new technologies.
Green Transformation of Ships
·Selectionof theBestRoute:Determine theoptimal routes forvoyages and shorten the sailing time of shipsbasedon theneedsof productionandoperationaswellasmeteorologicalandotherconditions, in the principles of safety and efficiency.
·DailyManagement:Replacethefleet'slightingwith energy-saving lamps, use shaft generators during voyages,reduce thefuel consumption of the generator，and apply self-polishing hull anti-fouling paint to maintain hull cleanliness, reduce resistance,and lower ships’energy consumption.
Xingtong 17 Obtained i-ship (E) Class Notation
On December 27, 2024,“Xingtong 17° started its maiden voyage. As an intelligent ship, the ship is especiallyequipped with anadvanced ship energyefficiencymanagement system,and therefore won thei-Ship (E) class notation granted by the China Classification Society (CCS). It is Xingtong Shipping's the first ship obtaining the class notation.“Xingtong \boldsymbol{{17^{*}}} is also one of China'sfirst batch of ships obtaining the i-Ship(E) class notation forintelligent ships.This notationisspecifically grantedto ships equipped withintelligentfunctionssuch asinteligent energy efficiency management,highlighting theadvancedlevel of the Company in intelligence and energy efficiency management.
Training on the Current Status and Outlook of Green Ship Development
In December 2024,theCompany implemented the philosophy of greendevelopment andresponded totheurgent demand forgreen,w-carbon and enviromental protectioninthe global shipping industry,and succefullyheldatraining event themed“Current Status and Outlook of Green ShipDevelopmentThe purpose of thistraining wastofurther enhancethemployees'understandingof greenshiptechnologiesandpromotetheCompany'scontinuousdevelopment and innovation in the field of green shipping.
Water Resource Utilization
The Company,in strict compliance with therequirements of the Water Law of the People's Republic of China, the Law of the People'sRepublicofChinaonthePreventionandControlofWaterPollution and other applicable laws and regulations,continuously improves water resource management throughprocess optimization, optimizes the tanker cleaning operation process,and take other measures to reduce water resource usage and improve water resource utilization efficiency.
The Company has reduced the amount of water used for tanker cleaning by adopting high-efficiency, low-waste equipment and operational methods, such as replacing dual-nozzle tanker cleaning machines with single-nozzle machines, and promoted the recycling of tanker cleaning water and domestic sewage to increase the utilization rate of waterresource.For the tanker cleaning operations for cargo change,the Company develops reasonable and detailed tanker cleaning procedures based on the characteristics and requirements of the current and next voyages to ensure the cleaning quality,shorten cleaning time,reduce water and steam usage,and decreasewastewaterdischarge,etc.
Indicator
Total water consumption
Water consumptionfor offices 1,835.30m3
Water consumption for ships 129,949.02m3
Water consumption density (ships) 88.28 m/1RMB1 Milion
131,784.32m3
Material Utilization
The Company activelypractice matria ecylin,ful prmts threycln f ackaging materials andusdmaterials rel ighweganddaefttmariat
Key Measures
ReductioninUseofPackagingMaterials
MaterialProtectionDuring Transportation
·Promote and support suppliers in reducing the useofproductpackaging and encourage theuse of reusable packaging. ·Recycle packaging materials as much as possible after theproduct is delivered to the ship to minimize packaging waste generated
·Prevent leakage, detachment, and damage during transportation to ensure the effective utilizationofmaterialsandreducewaste.
Reuse and Recycling of Waste Materials
Reduction in Procurement of Disposable Items
·Recycle and repair old tools, equipment, etc., toextendtheirservicelifeandreduceresource waste.
·Reduce the purchase of disposable items to minimize the consumption of single-use materials and the generation of wastes.
Green Office
The Company advcates greenoffice,launches the GreenOffice Initiative and encourages evey mloyee to start frm th smalthingsaroudthmandjontlprmtethgrenoffceamingtreategreenerandmoreustainablorin ronment.
Energy Conservation and Emission Reduction
Reasonably adjust the air conditioning temperaturetobenolower than 26°C in summer
Encourage the shared use of equipment with high energy consumption, such as projectors and photocopiers, to reduce idle time and increase equipment utilization rates
Paper Saving
Use double-sided printing paper，display materialson electronicscreens atmeetings andadoptelectronicvisaforseafarercontracts to reduce paper consumption.
Promote the use of email, cloud storage, andother toolstoreduce thetransmission and storage ofpaper documents,achieving paperless office operations.
Green Mobility
Encourage walking,cycling, or using publictransportationfor commuting to reducecarbonemissions and helpprotect the blue sky and white clouds.
Greeningwith Plants
Place green plants in the office to improve airquality，enhancethecomfort of the workingenvironment,andcreateagreen atmosphere.
Protection of Ecosystem and Biodiversity
The ocean is the blue home where human beings rely on for survival and development.The Company is well aware of the vital importance of protecting the marine ecology. Adhering to the philosophy of green operation,we take the initiative to identify and assess the potential impacts of ship navigation and related business activities on biodiversity, and effectively respondtoandcontinuouslymonitortheidentifiedriskfactors.
Optimization of Routes
ManagementofBallastWater
Whenplanning navigationroutes,wefullyutilize the automatic route inspectionfunction of the Electronic Chart Display and Information System (ECDIS), setting Particularly Sensitive Sea Areas (PSSA) and important marine biodiversity protection areas as no-go areas. This ensures that ships avoid these areas during navigation, effectivelyprotecting biodiversity.
Adhering to therequirements of theInternationalConventionfortheControland Management of Ships' Ballast Water and Sediments,weinstallefficientBallastWater Management Systems (BWMS) on ships, and standardizeballastwatertreatmentprocedures, including cleaning and inspection before ballast operations, conditions and methods for ballast water exchange, and key steps for handling sediments and preventing its entry. We ensure that ballast water discharge duringnavigationdoesnot cause abnormal migration of marine organisms, maintaining thehealth and stability of marine ecosystems.
We also take measures (such as optimizing the design of shipping routes, strengthening the management of ballast water, and implementing the implementation of noise reduction in navigation) to activelyprotect themarine biodiversity,and ensurethat the Company'sbusiness operationsdonotcause any damage or interference to the marine ecology.
Reduction of Naviga tionNoise
The Company prioritizes noise reduction duringtheshipdesignandconstruction phases, adopts low-noise equipment and reduces speed when approaching Particularly Sensitive SeaAreas and marine biodiversity protection zones, thus effectively reducing noise andvibrationfromthepropeller and engine room equipment. Measures are taken toreduceunnecessarynoisesourcessuchas deck operations, to minimize noises and protecttheecologicalenvironmentandbiodiversity of these sensitive marine areas.
eyIndicators
PercentageofApplicableShipsImplementingBallast Water Exchange/Treatment in the Fleet 100%
Enhanced Defense Line: Safeguarding the Safety of Shipping
Safety is an important guarantee for the Company's steady development. Treating safety as a commitment and responsibility, we always adhere to the safety red line, strictly fulfill safety duties, and continue to provide solid support for the high-quality and sustainable development of Xingtong Shipping.
Governance of Navigation Safety
ThewateaytrapfliqddanerdssextrldangerusMaacidntscasdycoliigrdnstr fireorexlsmui tetraptatinfshansaftdetsaatrepd takettrctltll as theLawof thePeople's Republicof ChinaonWork Safetyand the Regulationsof the Peoples Republic of Chinaonthe afety OperationandPolutionrevetioManmetfhipthCpanyahretthemanagment priiplfuinsaffist maintainttthtqldpritinetactilts andthewraxrltn tnpr ronmentally friendly and high-quality transportation services for our customers.
During theReportingPeriod
the Compan invested RMB 15.78 milion in safey production and imlemented safety management in an orderly manner, and no safety accidents occurred in the Company throughout the year.
I Governance
Based onintnatinal and professnal management rquirementsweestablihasaftyqualtymanageent systemSMtld tour characteristiheCmpanyhas alforlatd aserisof safetymangement rgulations suchas theSaftyMaaent Manual and theGuidlinesfor ShpOperationandManagement tocontinulymproveits refind safetymanagement veAsf 2024,theCmpayhasbehnredasaSaftyandtgityCmanfrcnsutiyearMulehipand catainf th CompanyhaveengnidsSaftyandIntgrityhadSaftandtrtyCatainsbythMariteaftAdnistr tion of the Ministry of Transport, respectively.
{0} Management Hierarchy
TheCompanhasetablihdaSaftanEnrmntaltetionCiteeundethardofDirectorswiththeGeneralMang erseingasteprmyreibepersnforafyprdtioneegsaftyglsandytakThCmanma ment tempnietinfetjtianmeuandeurnthachevtThMarpetant Engineeant arensilraaigadetinsaftydicatorsandntislronthsaftaabit of all employees.
The Comayasdvelod aSaftyProdtionRensiblitySstm and sigsasaftyreonsibityarmet with eachr ment andeachrepileernaalltensurethatallelysstrictlyfufltherprmaryrpnsibityfor aftprotn Anasssmentandreward-punismentechanisasbeenestablishedtvaluatetheperfomanefrelevantpersolinch ingthesaftyprdctiontargtsbasedonthaftPrdutionGolAssement andRewar-nismentMeasuretencura ship/shore employees to implement the Company's safety and environmental protection policies.
{0} Training and Assessment
InacordancewiththeQMPersonel Training redrs, theCmanyfomlatMAual Training laevyar, an plementsMtrainng adamentforreuitsandtraferdpersaptainsandothereltdshr/shpere tensure that shorehperaethe abltyeteandeet thCmanfetyhathentl rtetd qualityrequirements,thereby guaranteeing the standardized operation of theSQMSsystem.
{0} Certification Audit
Inaccordancewiththeestablishedmanagementprocedures suchas the Internal Audit Procedure and the Effectiveness Evaluation and Management ReviewProcedure,the Company develops and implements an internal audit plan every year to standardize the audit of the Company's safety management system execution on both shores and ships. The Company also regularly produces SQMS system operation analysis reports and effectiveness evaluation reports, to promptly implement corrective actions for non-compliant items and ensure the effective operation and continuous improvement of the safety quality management system.
During the ReportingPeriod,the Company ensured the safety quality management system complied with applicable international and domestic rules, guidelines,and standards such as the ISM/NSM regulations, and maintained thevalidityofrelevantcertifications,suchas the domestic/interna tional DOC (Document of Compliance), SMC (Safety Management Certificate), and ISO 45001 Occupational Health and Safety Management System Certification.
I StrategyI
| Risk Type | RiskDescription | Financial Impact | Imact Duration | Impacte Chain | Countermeasures |
| Legal Risk | Companies in the shipping industry are requiredtocomplywiththeregulations ofdomesticandinternationalmaritime thganiztiVislatnons tberappiaey laws andregulationscouldresult in significant fines,litigation,or penalties such as or- | Costincrease | Short-term | Operations | The Company strictly adheres to domestic and international laws,regulations,and con- antadsptaorsrntaet staads ment practices, continuously improvingits safetymanagement system. |
| Operational | increse | Short-term | |||
| Reputaton | RevenueDe- | Long-term | operatons |
| oportuni | Description | Financia | Dmractn | Countermeasures | |
| Marketies | In today’s market environment,custom- ersarepayingmoreandmoreattention a higherreputationinthe industry,and gainmorefavorfrom customers. | Revenue | Long-term | to | Continuouslyoptimize thesafety andqual- vices, and earn customer trust. |
I Impact, Risk, and Opportunity Management I
TheCompanbuildandmprvethedualprevntionmechaisf saftyrisclaictionancontroladhiendangeeti gationandmanaementfomlatrcdreuhasthercdureftheenticatioaluationandConrlfupat HeathHazadadntiulrthrconrolandhiddanerstigatianaagmnt abitfshands personnel, toeffectivelycontrolsafety,healthandenvironmentalprotectionrisks and ensurethesafetyof sh.
{0} RiskGrading and Control
TheComayclaiaftyrisinriselatdtratolactiiriselatdtlitneqpntari relatedtcuationaldseeazardsandestablhistfRisurceandaitfMajriskurceovrinperation actittdtr repndiadtrigridrairvpremjr the source and eliminate and curbmajor and catastrophic accidents.
? HazardIdentificationandManagement
The Comany clais accident hazards intobasicmangement aidenthazards" and"prouction site accident azards", and sta dardizetcrieradtfazardeitni extatital tions andn-siterisioheck, theCmanrtlyentis andelnt accidt hazardrajazadsthe nyfmsateiestigatnttgazeaetlaevpmjraidtaardrctit and conduts follw-uassements after rectiication,withdsignated ersoneverifying and cloing relevant cae.
{0} Emergency Management
In accordance with theEergency Response Lawof the Peples Republic of China, the Measures for the Administrationof Emergency ResponselnfrPrdtionafAidetsandthealialelandlationthayfolatserif gencymanagement systems andproceduressuchastheEmergencyResponseHandbookand theEmergencyResponseProcedures forShipandhoretmtanardidemergenyaagement systFraltfsaftyncidentshssherato safetytoxicqdethdmapiratjacknthtablhdstade anisbwehrendshpeinegeyntat,eradmergenyactitenureffcti of ship risks and accidents.
Totesthecientity prcticabitadrabityf ergenylsnd re th abityane accidntsarpriatl emergencysituations thCmandattheanual shshrejont drilslanveeardin tthFiearanfh hore Jont ril condtsrehensi shpshore egencydrll and takecontis valuatinandmrvemnt mease ensure that such plans can cover all emergencies identified by the Company infive years.
Case Study: Ship Anti-theft and Anti-hijacking Drills
In March 2024, the Company carried out an emergency drill of anti-piracy and anti-hijacking of ships, which further urged the ship/shore-based personnel to be proficient in emergency response process and improve the effectiveness ofcrisis management through the training and pre-drills of emergency response procedures,instructions, emergency response plans and equipment testing.
I Indicators and Goals I
TheCopayntantlulstrnsaftydeneardtlg-tafgfzeraideteraat lution zetentn,ercar,flatthanrti saftmanagent tivlsardgly,ana out quarterly tracking statistics to ensure the effective implementation of all safety work.
During the Reporting Period
During theReportingPerid,the shipsafetyand anti-polutionmanagementmet theCompany'sestablishedrequire ments,and successfully achieved the overall goals of five“zeros”and three 900%s^{\prime} ，
| S/N | SafetyManagementObjectives | Achievement |
| 1 | Zero Accidents | Achieved |
| 2 | Zero Casualties | Achieved V |
| 3 | Zero Pollution | Achieved |
| 4 | Zero Detentions | Achieved |
| 5 | Zero Cargo Losses | Achieved √ |
| 6 | 100%PassRateinExternalAudit | Achieved |
| 7 | 100% Pass Rate in Inspection by Oil Companies | Achieved |
| 8 | 100%Success RateAgainst Typhoons | Achieved √ |
Protection of Safety and Health
I Protection of Navigation Safetyl
BasedonitsQMSmanagent systm,theCompanydeeplmlents andcontiuuslyroveshipafetymanagemet or fromasptsuchasshipperatinmanagementmantenanceandfireafety,tensurethsafenavigatinf cmanyh
| Ship OperationSafetyManagement | |
| Management of Ship Operation | The Company has developed procedures such as the Shipboard Operation Plan and Instruction Formulation Procedure and other procedural documents.For shipboard operations (including key operationsand dailyoperations),detailedoperatingproceduresapplicabletoeachshipbasedon its characteristics must be formulated.Through training,guidance,supervision andinspection, theCompany ensures that all operations are strictly executed in accordance withapplicablereg- |
| Ship Maintenance | ulations,laying a solid foundationfor safe navigation. The Company has developed the Ship and Equipment Maintenance Procedure,strictly approves the Annual ShipMaintenance Plan,andpeformsmaintenanceand servicingof ships and equip- ment at appropriate intervals as planned.The Company regularly tracks the execution process, and promptlyeliminates equipment defects,thus ensuring that the shipand equipmentmeet do- mesticand international regulatoryrequirements and that the ships areinnormaloperation and |
| Ship Supervision and Control | The Company conducts daily, quarterly, and semi-annual monitoring inspections of ship/shore operations.Non-conformitiesif identified areanalyzed comprehensively,andSQMSoperationsit- uation and results are promptly reported to senior management of the Company.Any issues en- countered inthe operationof SQMSareresolved to ensure the effective execution of the SQMS st tracks the ships under their control throughout thevoyage.Through activities such as accom- panying the ships during their voyages and conducting onboard inspections, they ensure that |
| Fire Safety of Ships | The Company solidly promotes fire safetymanagement work,promptly equips and updatesfire safety equipment,regularlymaintains and servicesit,and continuously strengthens crewmem- each quarter to ensure fire safety on ships. |
| Safety Management for Related Parties | The Company has developed the Stakeholder Control Procedure,which outlines the methods and requirementsfor managing stakeholdersthat may pose environmental or occupational health ads tions,theCompanypromptlycorrects anyviolations,andensures that stakeholders implement the Company'srequirements forenvironmental protection,occupationalhealth,and safetyre- quirements, etc. |
| Empowerment with Digital Application | The Company keeps pace with the global development of maritime information technology. Throughtheapplicationof industry-leading shipping safetymanagementconcepts and advanced technologies,the Companyhas established high-throughput satelitebroadband systems,CCTV smartmonitoring,lbehaviorrecognition,andnavigationsafetyassistancesystemshesesys tems enable thecollectionof shipnavigation data,engineroom equipment operation data,per- sonnelviolationbehavioralerts,andother datatobuild anintegrated smartnavigation safety management platformforship and shore operations.This significantly reduces safetyaccidents causedbyequipmentmalfunctionsorhumanfactorssuchasmachinefailurespersonalinjries, ship deviations, and anchor dragging.The Company is gradually achieving“all-process, all-ele- ment, alltime domain inteligent navigation safetymanagement for all ship types in the fleet, creating a globallyleading intelligent navigation safety brand in the industry. |
Case Study: Special Fire Safety Action for Ships
In May 2024, to thoroughly implement national laws and regulations on ship fire safetymanagement,prevent ship fire accidents, and enhance ship fire safety awareness, theCompany organizeda specialshipfire safetyaction. Through fire safety publicity,fire safety inspections, and rectification activities, the Company aims to comprehensively improve the fire prevention capabilities and management level of ships, ensuring that ships maintain a safe and effective fire prevention status throughout their long-term operation.
{0} Inspection on Ship Safety
FocusingnlementinglaStatControlC)PrtateControlC)EShipectioneprPrrampetion n Insectisthmynhatheefthtionlstafstrethnrrat inspectionsandrtlcotsaydeiciencidentiddngtioasrequidhsngongeffr atnti improve the Company's ship safety management capabilities.
| During the Reporting Period | |||
| Number of PSC Ship | Number of PSC Ship Detentions | Number of FSC Ship Inspections | Number of FSC Ship Detentions |
| Inspections 27 | 0 | 38 | 0 |
| Number of SIRE Inspec- tions | SIRE Inspection Pass Rate | Number of CDI Inspec- tions | CDI Inspection Pass Rate |
| 64 | 100% | 6 | 100% |
I Safety and Health of Personnel/
TheComayaseveldserieofcpatinllthand saftyreulationsing thOupationaHathMnge Systemefullyutizethftionsnlef thhSaftyiteandsfetoffieprtydetfyhr risknht tarttvtlitdi andsafeguardthehealth andsafetyof thecrew.
{0} Protection ofOccupational Health
Inresponetoalleratinswithtentihazardssuchastheusofchemicals inshenginromsandthesuaceperati high-temperature equipment, the Cmpanyhas developed systems such astheOccupational Disase Protection Equipment Manage ment System and the OcupationalDiseaseHazard ProtectionFalities Maintenance and RepairSystemAl shipsof theCompany havbeqfit lprttqu iqyh chemical preti ger, and ar prdd wthrelantpratiomauals eratin predr andrelatdguid dt. Thedailantnaeancarfprtctivfaitiarlntdturthmlndaferatinfquipet hensively promote the standardization of ship operations, and guard the safety of personnel.
{0} Occupational Health Monitoring
The Company formulats systems such as the Oupational HeathMonitoring and itsFle Management System, invites thirdpa agencietarrytwrkleupationldihazarstestinevrandoranizcuatiolhelthchkup ployeesengagdxpuretccupatildisaehazadsandinfmsmlyesof threlevant test reultsfitulWactil takemeaetwrindianprttifilarngreticarndatodn prov thehealthprottioworadiion,theCmpanystanardizesthemanagemet f emlyccpatinalheathmt fpririltldisisditt visionfromhealth management departments.
PromotionofOccupational Health
TheComanseveled thupationHathcatinandriinSystandutiliedvariousmethdssuhasi barditaad prmoteccpatolhathontnt oveegulationwystemsandpeatinreureenpat diseasepreentionndcotroandthorretfccupationldiaprotctiqupmntrdntiula employees'self-protection awareness and abilities.
Care about Mental Health
TheCompanplacs great rtacenthementalhealthof its lyee.eactivelyorganize pycholcal helthlctu d trainingsesiondyextlprofssionalsuhspchlgialousrandprvidpchlgiloulngaistane guidance to employees aiming to improve their mental heath and create a healthy working environment together.
Construction of Safety Culture
I Safety CulturePhilosophyI
TheComestadstafaftycleriltntapiridie tonstrtfa tinandarictrldzatotmanuiddythelsadftyniidtreal five"zerogoals.TheCompany continually deepens,innovates,and enhances ship safetymanagement.
I Safety Integrity Honors
TheComanyalwaslaesafetmanagemntat thecorestratgicpositinandcontiuestoinreaeinvestntinsaftwih uwaveridntiitsansttrtienth strengtheecrewsfetytrainn,theCmpayhasreeivdariofhhlyprestigioushnruhasaftyandIntgrit pany”,SaftyandIntgrityhip, andaftyandIntgrty CmanyThisisnt onlahihregnitionfrm thendstry foth Companysast efrtsut alstrogmtiatontpirethaytmefwd thefure thCmanwil cn tprmtgqualtevlyahntrtaftmeteiequaltynmratis models.
| Safety Integrity Company | In 2018,the Company was awarded the title of “Safety Integrity Company”by the Maritime Safety Administration of the Ministry of Transport.As of 2024,the Company has maintained thishonor for 7 consecutive years, and become one of the few bulk liquid chemical shipping companies gaining such a honor. |
| Safety Integrity Ships | In 2024, there were 8 ships with valid honor certificates of "Safety and Integrity Ships". |
| SafetyIntegrity Captains | In 2024,there were 12 captains with valid honor certificates of “Safety and Integrity Captains". |
I Safety Culture Activities I
Safeteafaiat develpmntstratfthmhmaittcarotarioaftrtiondtrainngactt ergwiraffhstrtillatdnienalindiit notonlhelremerastetheoretafetyskilsthroughpractialperationsutalsnableshrebasdpersoltgan adeepererstandinof thcotatif saftycuuefdifent pctivrogcontiuslengand pratll emloerstafftuufhtrataabiasii strengthened,thusbuildinga solid and reliable line of defenseforthe safeoperations of the Company.
Inthefutu,tayiltitvatsatprtianrntdnilrthaft ofall emplyeesandensurethatsafetycultureistrulyintegratedintothedailyworkandlifeofeachemloyee.
? PracticeHighlight1:ActivePromotion ofGoodSafetyPractices
Tofullyetsutiitdesfceetat sdef lprevent saftacidents, thayasfoated theMeaurefrCltioandlmentationfGodPractiactil advocated and promoted the evaluation and reward mechanism for“Good Practices" The Company colectsthe“Good Practices" proposedbycrmemersandshor peronel while alseting scoringmchanimtreward otstandinGodPratis These pratiarthprtd wi thf hptin adipratithhpsafe evaluation,collectively promoting theimprovement of the Company's safety management.
During the Reporting Period
During the Reporting Period, the Company collected atotal of 120 good practices, and the shore-based review team evaluated/reviewed a total of 40 practices and sent them to the fleet for sharing.
? Practice Highlight 2: Promotion through Shell Marine Partner in Safety Program
OnAugustthaththalfhelfial thheaatyrgrd memberof thisaershhsmarksoldstfowardforthCmayinprofesional exhangewithn theidustryandi moting andenhancing thelevel ofshippingsafetymanagement.
TheComanyactilrpdd thelstreeactioniatidedits saftctet striclyfowe theq mentstartarosactitadrllethftisfthectitiiseftsttht safetycleatealldertlldclteef cient working environment on ships.
Shell MarinePartner inSafetyProgram
{0} Practice Highlight 3:"Safety Production Month"Themed Activities
Inune 224 tofuhelment thertant istrutionnafetyprtionbGeneraecretaryXiingthCmany niedaserifaftytioMonthactiviwithththeeyneasfSafety,EveyonewsergeyR to Smoothen Life Passage".
{0} Full Mobilization
At thebeginningfafetyMonthactivitiestheCompanyissudacalltsolicitatevideosforthe202SafetyProdutio Monthactivelencurgdal shipstpartiipateflmingganidforthesaftyroutioonthwidelprt edthe event throughtheWeChat OfficialAccountofXingtongShipping,andheld thelaunching ceremonyof theSafety Production Month” onboth shores and shipsSeniorleaders and emloyees of theCompany participated together, inspiring enthusiasmfor allemployeestoengage intheevent.
Launching Ceremony of the“Safety Production Month"
United Cooperation: Building Sustainable Development Together
Adhering to the vision to become a world-class, domestically leading integrated service provider for chemical supply chain, Xingtong Shipping continuously extends the field of chemical supply chain services, provides high-quality, safe and diversified all-round supply chain services, and joins hands with various partners to build a mutually beneficial and win-win industrial ecology.
Enhancement of Development Resilience
The Company steadily advances the "1+2+7" strategic development plan, continuously improves development resilience, grasps opportnihsttlistasaeteratpifunci striefodstst ciicadrat talatfttlieadrtlst complancenstrutowhlpursunqualtroetostedtiondefciecynaemntinparaleit valecreatnt hnillaeheratlefiinaytsnrd ment ad anntlient atnhlgyntslypremat tieserationleffce overall profitability, and to take leadership in sustainable high-quality development.
I Governance
TheCompanylmets theericephilpfLadinicewtherymlCarinfrustmerearedit testabinglg-tstalerelatiohipwicusmerrughthfolionfrlvatsystsuhastrart Service BusinesManagement System,theInteational Transportatin sinesManagement System,the hiphore perationS tmandtheustomeatsfactionuyadCmlaintMaaemntredreestandardizethCmanusinerat improvecomnicationandcoperationeffiencyamngdeatments, andenable theComanytcontiuslprovidehigh-qualt and first-class services to customers.
TheComan deins the relevant repnsibitieof the deparmnts ivlvd inusissericeThMarktinparet s sonsible frfrontend seicesuchascustomercontract handling,customerrelationshmaintenanceandcustoer demand searchTheperationsDeparnt isreonsiblefortaskssuchasshpvyaeexcutiontensure shpcomlet thetranprtati tasks inqualityand quantityacording toyagerderinstructions.Otherrelevant departments providenecessary supr.
I Strategy l
| Risk Type | RiskDescription | Finapncial | Duraticon | Vanupecthain | Countermeasures |
| Operational | If issues arise in the process of ship de- crease in operational costs. | Cost increase | Short-term | Doperateasn | Standardize the Company's transporta- tionservices,freight forwardingbusi- ness, and other business management search,voyage planning,ship oper- ationmanagement,etc.,toprovide high-standard services tocustomers. |
| Reputation | Revenue | Long-term | Doperatean |
I Impact, Risk, and Opportunity Management I
TmrocustmeeiclelsandenhacusteatisfactionthCmaasfoatdystemuhastrapat ServiceBusinessManaemet Systetolement stadardized seicework andcontrrisksuring theustomer eice press additionstrngththaentfstmereraneaabitdrismanageettaynts riskasmentsaed ontheCustmevaluatioMangemet Systaronddiensionssuchasthenaturof theentepris istedcattria ments, and take proactive and effective measures to prevent and reduce risks.
I Indicators and Goals I
Toprovide customers withbetter,more efficient,and attentive shipping services, the Company pays close attention to customer feedback,promptly collects, organizes, and analyzes information such as customer complaints and satisfaction data, and makes continuousimprovement and optimization.
I Optimization of Customer Service
? Deepened Communication with Customers
TheCompanyfolatethTranprtatioeiceBuinessManagementSstemandotherelvatystemstestabihstandrdi andeficetieicagetengfllictowcuseranbldgodrelath Companyrcustdmadalistderstandthdfctmrstftraprtatioaritiqat lading andladnprandtandrenablalatetheeodin shpstenureefcnt and thtrapat sericeurithetrrtatieicpressthayalrhnitrckfveldinrt transportatinladinperatinanddumntolctinmintainntelnicationndrelationhmintean customers,further enhancing customer trust and satisfaction.
Customer Satisfaction Management
TheCompanyatchsgret tanetcustmerfedback ontiusly strengthensnicatinwthcutomrestabli sntilttfts calanalidadothealyisastrgtheanrwekarouslafesnl ties and qualities, to provide higher-quality services to customers.
| Customer satisfaction surveys | |
| Indicator Principles | Accurately graspkeyindicators of customer needs; Create controllable indicators that generate new expectations in customers, prompting the Company to takeimprovementmeasures; Focus on quantitative indicators that can be counted,calculated and analyzed. |
| Surveycontent | Cover aspects such as ship transportation, service capability,and comprehensive evaluation. |
| Survey Methods | Use email,phoneinquiries,fax,questionnaires,visitrecords,forums,and otherforms; Require each department to hold a discussion meeting every month to analyze and improve shortcomings in management. |
| Analysis and Processing | Summarize and statistically analyze the customersatisfactionsurveyresults,recorded inthe Customer Satisfaction Summary Table and the Customer Satisfaction Statistical Analysis; Organizerelevant departments to investigate andhandle customer dissatisfaction projects, andfeedback theresults to customers ina timelymanner; Convene the relevant departments of the Company to organize special meetings, inform the situation of customer satisfaction survey in a timely manner,analyze thereasons,and urge the relevant departments to formulate corrective and improvement measures,and fol- low up the implementation of the situation. |
{0} Handling of Customer Complaints
The Comaycontius topayatetiontustomens, deins thepecificdtiof eachrensible depant in thCstm erComlaintManametSstmandfomsstematicandstandrdizedpresforreeinanhnlicutomcmlant sastquildifsiutsfteftilrdt and interests of customers.
Intelligent Shipping Ecosystem
Digitalizationisakeyenablerforthe shipping industrytoimproveitsresource allocationcapabilities and achieve new momentum in business development. Responding to the national call for green,low-carbon,and intelligent shipping development and catering to the evolving needs of the Company,we continuously promote innovative breakthroughs in new generation information technology,diveintothe applicationof“digital shipping and smart ships,andextend thesetech nologies into the supply chain".This covers the construction of projects such as business management systems,infrastructureconstruction,datasecuritymanagementsystemsandintelligent ship systems,to comprehensively enhance our fine management capabilities.
In 2024,the ShipOperation EfficiencyAnalysisDataset independently developed by the Company was awardedashipping dataintellectual propertyregistration certificatebytheFujianProvincial IntellectualProperty Protection Center.This achievement significantly enhanced the operational efficiencyof theCompanysshipping platform,and effectivelytransformed datafrom“intellectual property” into“assets", marking a key step forward for the Company in the field of new quality productive forces.Inaccordance withrelevant accounting regulations,data assets were first included in the balance sheet of the Company.
During the Reporting Period
Case Study: Intelligent Ship Systems
UpholdingthevelntphilphfnggreennteligentadeffcientthComanysstablishdantl gent platformfor shipmanagement, whichcoversfunctions suchas shipequipment monitoring,navigation path optiiza tion,fumanagmentanremtemantenancdataotion,tramissio,andstraesystmasalsbenit t meet the full-process operational management needs of ships.
Real-TimeShipStatus Monitoring and Warning System:
Intelligent Navigation Optimization System:
Thereal-time status monitoring and multi-levelwarningfunctions havebeenrealizedfor key equipment on ships such as the engine, the fuel system, and the navigation system. Through real-time data transmission, key equipment status informationcanbe shared between the shipand shore.Onceany abnormality is detected in the equipment,the systemautomaticallytriggersawarningand sends it to the shore-based support team.
Intelligent navigation optimization modules have been launched, integrating external data such as weather forecasts, ocean current speeds, and channel data to provide crew members with the best route suggestions. Thishelps ships reach their destinations safely in the shortest time possible. The platform canpredictpotentialweatherrisks along the voyage and promptly alert ships to adjust their routes.
Remote Maintenance and SupportModule:
Monitoring and Management of Ships' Energy Consumption:
A remote maintenance system has been established, allowing the shore-based support team to remotely monitor and diagnose ship equipment, provide real-time technical support, reduce ship downtime due to equipment failures, and improve the continuity and stability of ship operations.
An energy consumption monitoring module hasbeendeveloped to monitor thefuel consumption and energy efficiency of ships in real time, support data collection and analysis, and provide management with a basis for optimizing energy consumption strategies.
Joint Promotion of Industry Development
Withannentpriatnhpactigtratpaertha pateininstnrdfhtrehagadothcttadrattstr tmWetraturadadantafalstakhlediusdstyvnt tredad harepractial epr and achievements, to promote the sustainable development of the Company and the industry.
{0} Joint Strategic Cooperation
Case Study: Strategic Reach Cooperation Between Xingtong Shipping and C&D
InNovemer24nrensetothewaefsulychainupgradesinthechemicalinustryandtlementthto aldevelopmentstrategyfGonglobalXingtonghippingofficillyigedastratgiccooerationframeworkareen with C&D(alisted companyunderthecontrol ofC&DGroupwhichisoneof theFortune 500 Companies),embarking on anewchapterof long-termstrategiccooperation.Adhering tothe philosophyof strongaliances and sharedadvantages, botharistregthnoeratiotladtheintatinlhicashppinnustytwarsintlientgr efficient develpmet.Troughsupplychanptimizationandvalcreation,theyfuheenhance theirabittseelag global chemical customers.
AdditionalltheComanyigedajointventurecontractwithXiamenJianfSupplChaingisticsTechnolgyCo toestablshjointventureamdat jointlpurhasinggreandhigh-endchemicaltankermeticulouslylayingout glbal chemicalmaritmebusiness.Byintegratingbthparis'globalresourcesandadantage,theyworktgethertcontrit totheimprovementoftheglobalchemicalindustrychain.
{0} Industry Exchanges
Case Study: Participation in 2024 (18th) Petrochemicals Storage&LogisticsConference
In October 2024, the Company actively participated in the 18th Petrochemicals Storage & Logistics Conference. At the conference, manyleading companies in the chemical industry, including well-known cargo owners, shipowners,freight forwarders,and storage enterprises，gathered together to conduct business cooperations (e.g., matching cargo owners with suppliers for vehicles and ships), deeplydiscuss andcommunicate onvarious topics in the storage and transportation field of the petrochemical industry, and explore the development of the industry.
Case Study: Students and faculty of Shanghai Maritime University visited Xingtong Shipping to outline a new blueprint for shipping through university-enterprise collaboration
InJuly2024inresponse totheSueyonThousandsof Enterpriss andHndredsofPortsinitiatedbyShanghaiMaritm University, a social practice exchange programforstudents of ShanghaiMaritimeUniversity,the Companyreceived arop of facultyand students ldbyseveral leaders whovisitd and exchanged withtheCompany.ocusing oncore topicsuh asindustrevlnt tredtalt cutiationand theprtuniiandchalngesinthindstrthpa gaged inin-epthandproductivdiscussionsTfurher deenuniversityenterprisecperation,thgeneralmanagef theCompanywasinvitedtoereasanextealmentorforthedelgicalandplicaleducationfortheClegeofTran port&CommunicationsoftheShanghaiMaritimeUniversityThislaysasolidfoundationforfuturein-epthcooperationf both parties and the development of the shipping industry.
Sustainable Supply Chains
I Management of Supply Chain I
Attachinggreatrtacetupplyhainecurt,thpanyasestablishedsystemsuhastheuplManaementt andtaelqltadlt uation,andmne raelsprt pmatrilshsol matriads materials, and build a safe and stable supplier team.
TheVicePresident inchareisrespnsiblefrapprovingprourement contracts and suplagrementsf theCmanywhi t Purchaiadlttigttidelutpru tractmahhimatrilaltaqalakadama Together,theyensuretheeffectivenessofsuppliermanagement.
I Full-process Management of Suppliers
TheComastablihdstadrdidcnpresfrmangislideletvaluoam achievedfull-processmanagement of suppliers.
Selection of Suppliers
The Company selects high-quality suppliersthat meet its needs based on factors such as qualifications, industry rognition,andindustrymanagementexperience,controlling supplychainESGrisksfromthe source.
Admission of Suppliers
Detailed evaluation criteria are set according to the markets, industres, products, and sevices involved, inclding suplequlstbildlii documntqualinltticiawritl a comprehensive evaluation to ensure material quality and protection of labor rights.
Supplier Classification
Based onthe comprehensive assessment resultsmajormaterialsupliers areclassied intothreecategoriesA Core CategoryB(General),and CategoryC(Emergency),and preferential procurement cooperationiscarried out.
SupplierAssess"ment
The Company conducts an annual assessment of its supplies, and assesses their perfomance in product/sevice qualityhealthafetirmentmanaemnstmertiatindmntatonasednths resultsthpligrasadstfulutruuhscreditqualitrieprh gradeisadjusted according totheseverityof thessuehe suppliermaybeblacklistedprocurementfromthemmay be reduced or stopped, and the qualified supplier list will be updated in a timely manner.
I Supplier Sustainability Management
TheCompanlaces great hais ontheG prfomance of its suplr.yinorprati Grelated rquiremets intth pliemanagement pre stregthning grenprourement adpmting tranparent rremnt mthdtheComan rates with supplier partners to drive the sustainable development of the supply chain.
Supplier ESG Management
For international ship management services and maritime labor services, the Company requires supplierstoprovidecertificationdocumentsforlaborrightsspecialworkpermits,and otherrelevant qualifications to ensure compliance with applicablelaws andregulations concerning labor rights,occupational health and safety,and welfare protection. In addition, the Company conducts ESG-related advocacy and support for suppliers, including efforts tominimize product packaging,promote package reuse, and recycle packaging after delivery to ships.
Green Purchasing
The Company prioritizes the procurement of environmentally friendly products with energy efficiency,long service life,and lowwaste generation,and uses products withecologicalprotection certification (G-ECO)whenever possible.For the procurement of a complete set of new equipment,a NoAsbestos Declaration must be accompanied.
Transparent procurement
The Company continuously strengthens the integrity management of its supply chain.Suppliers are required to sign an Integrity Cooperation Agreement or include integrity cooperation clauses inrelevant contracts,clearly defining theethical standardsforbothparties and jointly maintaining ahealthy and fairbusiness environment.
100%
On-SiteInspection Coverage Rate
for Core Suppliers
Protection of Information Security
I Information Security Management
Inaccordance wththe riniplf“risk rntationfllpartipationontiusveet cliance andrnsibit inlinewithwsandregulationssuchastheDataecurityLawof thePeplesRepublicf ChinatheetworkecurityLawf th People's Republicof Chna, thePersnalIformationrotectionLawof thePeles Republicf Chna, theCompanyhasdeveloped sy temssuhstheCmterfomtionecurtManaemetyst,thCmuterssetMangementSystmandtheatan SecurtyManageet ystadestablshdastaleinftionsecurtmanement ytmeectilenreth saftf t Company'sinformationand data.
The Digitalizatinepant seng asthecoreof thCan infmatiomangeme strctueds infmtionmanae and infomatizatiworheInfmatieurtyTasFrelemnts infmatioeuritandprivacyprotctiostratgin managemeesiblefrisiomaigandsitanCliaeantpidl port.Each business department ensures the implementation of relevant policies at the low level.
accordaetnadistdulattmefelptsstit data security management,ensuring data security throughout the entire project lifecycle.
O data security violations or customer customer information leaks occurred in the Company.
I Improvement of Security Assurance
TheCompany stritllentsinfmtionscuritycontrntinuloptimizingandirvinseuritymeasurestoenue fective control of information securityrisks.
I Information Security Cooperation I
TheComaelyfolsthdvelnt tresfutigethlgisuhasshpintlieceftizaonand Aandsiltaeusllemntifmatidtertmanemetdgthactirtionfdilontrtim panycollaoratswithqualiedextealorganizations suchastheCangqiongCntelationloudPlafomandotherexteral ce atoprtatt riskidentiiatnndmaamntnuetrivcgitndvailaifdtahloer
Shared Responsibility: Seeking Collaborative Growth and Mutual Prosperity
Xingtong Shipping has always regarded employees as the core driving force of enterprise development,andcontinuouslyabsorbs,cultivates,and introduces outstandingtalents.Through improving welfare benefits and incentive mechanisms, we build a stable and efficient talent team,and solidify thefoundationfortalent development.The Company activelyfulfills itssocial responsibilities, and engages in community development, rural revitalization, and social welfare activities,to achieve mutual prosperity of corporate development and social value.
Protection of Employees' Rights and Interests
I Compliant Employment
StrictlyaheringtotabwfthlReulifChntheabrontratawfthelepublifChnat Lawof theeleRepublicfChinnlyentPrmtion,thanysfoulatdsveralmanaementstemsl the Emplyee Handbook,theRecrutment and AllcationManagement System, and the Shore-based Emplyee ResignationManage menttstdirr Toelmnatehlanfredlar,thCmaystrgthesprelent detericatichktef cani tenureliancewthgalreulatioadstritleordailwrandretchaniacrngtatndaerelads tems.
Baseditstalvstratyalacraccrnrila troducestaletstroughdiversidreuet chauchas-camsrecitentventceratiowthdmesticrecruin platfomsintlndionsan prxchaneaddiion thCmayestablshpaershwihcoland sitiesusarersityadQuazhcsttttiitaltynttvelntftall
I Diversity, Equality, and Inclusion /
TheCompanyvalus the equalityand diversityneeds of emloyeesaccordance withtheMasuresfor theAdministrationf m plyeeEmlymentandtheprinciplfequalmloentwconductreruitentworktensurethatthereidiriminatio icreadri the legal rights and interests of each employee.
Shore-based employee
Number of Shore-Based
Employee
136
Number of New Employees mT 21
Employee Turnover 7
Employee Turnover Rate 5.15%
{0} Shore-based Employee Structure
Total Number of CrewMembers 595
Number of New Employees 189
Number of Employees Resigned 86
Employee Turnover Rate 14.45%
{0} CrewStructure
The Company actively creates an inclusive and diverse corporate culture,and encourages mutual respect, understanding, and cooperation among employees. Through various channels such as the internal publication Xingtong·Seaway,bulletin boards, and official website,the Company promotes its values and cultural concepts,ensuring that employees from differentbackgrounds andpersonalitiesfeel theCompany's care and respect, thereby enhancing their sense of belonging and recognition.Additionally,the Companyfully considers the needs offemale employees.While ensuringlegal rights and benefits for female employees, such as marriage leave, maternity leave,prenatal check-up leave and breastfeeding leave, the Company has added special leave—menstrual leave—to provide convenience for female employees.
Optimization of Remuneration and Benefits
{0} RemunerationManagement
The Comanyahretth priipl that remeratio shulbe“comliant, etitpsition-based pefomance-orinte andadjustableBasedontheLabraofthelesRepublicofChinandotherrelevant policombindwththCman realities theCompanaestablshed systemsshasthehor-basedmlyReneratioManagementSystmand thCr RemunerationManagemet Systemtregulateshore-based andcrewremunerationmanagement.Comited tbulingascientic reasonablaadetieratmem tmtayuieteadstnt adentit ofremertftattntitletart and the achievement of corporate goals.
WithahridreeratistratyandbasedoerationlvelsandreratstruturethCmanaptsdifert strat egiesforthrertionfmldiffrentjlelsandpsiincrwrmeratnetmdwhmarkba approachandbasedonthecontributionofindividualcrwmembersdeciding theincmelevelof thecrewheCompanyhasstab lishedaclectivaluatioechanisdbtheCrwepamntwithpartiipatinfrmulileepatentstadjustcr munerationnlnwithftuationsnlabrarkt priceveimnththerebyrvin thecrwcmensation structue syst
The Company insists on optimizing the talent incentive mechanism and establishing a diversified,multi-level incentive system.Thisfully stimulates employee enthusiasm and creativity,and achieves long-term mutual development between the Company and its employees.In 2024,the Company implemented an employee stock ownership plan to provide incentives to the Company's directors,supervisors,officers,and key personnel, further enhancing the cohesion of employees and the development vitality of the Company.As of the end of 2024,the Company's employee stock ownership plan covered 55 employees (including overseas employees).
the Company's employee stock ownershipplan covered (including overseas employees). 55emplyes
IManagement ofPerformance Assessment/
For regular assessment and objective evaluation of employee performance, the Company has established the Shore-based Performance Management System to standardize mechanisms such asperformance assessment,performance interviews and appeals, and improve its talent incentive and constraint mechanisms.With an overall performance system oriented to the business strategy,the Company adopts tools such as the balanced scorecard and KPI (Key Performance Indicators). With a focus on departmental performance evaluations, the Company has constructed an integrated KPl performance evaluation system.The two main tools of performance management are introduced to link departmental performancebonuses with business results.A mechanism that connects employee earnings with company performance is established topromote mutual growthbetween employees and the Company.
Key. 2024 Performanceill
the percentage of employees regularly undergoingperformance andcareer development evaluations was 95.59%
I Improvementof theBenefit SystemI
TheComanyaherstoaple-centerd philpyand adcatesanatmspheref healthylehappyworkWehavestab Iished thhrebasdlWareManemtstman thCrefaestroviealllywhe hensivewelfaresystemthat ncldesthreemajrpartsstatutorybenefitcorporatebenefitanduninbeef.
IntermsofworkighurandvstheComanyforulatestheShore-BasedEmloyeeAtendanceManagementSystmtsta dardieatdncaant adrtt lyhtstwrtandtaandlnts-frli systemandprovisinsnlsfortraln-clocinatedancesystmisinplaceforthemlysinthetationalBuss Center whed tdel wthjt lgadditon th Cmanyalstakeintfulact thelingedof ely.ly with childreninkindergarten orelmentary scholcanapplyforleavetoassist with their children's schol commute and ari 30\min- utes later than the morning work schedule of the Company.
Regardinthwrurftcraliitgulatipreetincrattablidl nisms such as work and rest time logs, and ensures that the crew receives adequate rest.
Compliant Statutory Benefits
Statutory benefits include social insurance,housing provident fund, paid annual leave, marriage leave,bereavement leave,maternity check-up leave,maternity leave,paternity leave,breastfeedingtime,andmedicalleave,inaccordance withnationalpolicies and the Company's relevant regulations.
Diverse Corporate Benefits
Corporate benefits supplement statutorybenefits and include accidental injuryinsurance, employee health check-ups,travelleave,seniority subsidies,phonebillsubsidies,and spe cial benefits.
Humanized Benefits from theTradeUnion
Benefits from Trade Union， as a beneficial supplement to corporate benefits,include team-building activities, annual trips,birthday gifts,holiday reetings,Women'sDay gret ings,wedding giftshospital visits,support for employees in difficulty,condolence visits, education scholarships, and daily welfare.
Employee Care and Support
{0} Enhancementof Crew Care
Dueto thespecial nturef theirwrking eviroetjrequrments, andwrkng hus,crmrs facehigerrsksto th physical anetalheltheareaut thhealthane-benof eemr anpatentiontvedetailf ti dalylifelinginbithadwthrt whandgits tcrmercatinthdrm sidering that crwembers areunable ttaketimelycarof thefmileettheirwokinghours theCompanyorganizecr familycare actitesto enhance mtional cmnicationweencrwmemberandtheirfamietrulping careandsup laceiihvist aaactiiaast,l moniesforretiredcrmerenurinthatcrewmmerfelseefpridanwamthdrgthitwiththCa
